Human Macrophage Colony Stimulating Factor Recombinant

Human Macrophage Colony Stimulating Factor Recombinant
SKU
BPS90215-A
Packaging Unit
2 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 33-181

Amino Acid Sequence: EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ

Background: M-CSF is produced by monocytes, granulocytes, endothelial cells, and fibroblasts. After cell activation, B-cells and T- cells and also a number of tumor cell lines are capable also of synthesizing this factor. M-CSF has been found to be synthesized by uterine epithelial cells in vivo. The M-CSF receptor (CD115) is identical with the proto-oncogene fms. The receptor is a transmembrane protein with an extracellular ligand-binding domain of 512 amino acids, an intramembrane domain of 25 amino acids, and a cytoplasmic domain of 435 amino acids encoding a tyrosine kinase. Human M-CSF is active in mouse and rat cells. The murine factor is active in rat cells but inactive in human cells. M-CSF is a specific factor in that the proliferation inducing activity is more or less restricted to the macrophage lineage. M-CSF is a potent stimulator of functional activities of monocytes.

Biological Activity: The ED50 was determined by the dose-dependent stimulation of the proliferation of  of M-NFS-60 cells is < 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg.

Description: Recombinant Human M-CSF is a disulfide-linked homodimeric protein consisting of two 149 amino acid residues, and migrates as an approximately 42 kDa protein under non-reducing and as 20-21 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human M-CSF extracellular domain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution pH 7.4

Genbank: P09603

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P09603

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. J. Exp. Med., May 2009, 206: 1089 - 1102.
2. J. Leukoc. Biol., Feb 2009, 85: 262 - 267.
3. Blood (ASH Annual Meeting Abstracts), Nov 2008, 112: 2887.
More Information
SKU BPS90215-A
Manufacturer BPS Bioscience
Manufacturer SKU 90215-A
Package Unit 2 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×