Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 59-128
Amino Acid Sequence: AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Background: The chemokine neutrophil- activating peptide 2 (NAP-2) is a 70-amino acid residue polypeptide that is formed from platelet-derived precursors by proteolytic processing. Mature NAP-2 stimulates various effector functions of polymorphonuclear neutrophil granulocytes (PMN) including directed chemotactic migration, exocytosis of lysosomal enzymes and secondary granule contents, and up-regulation of adhesion receptors. NAP-2 has been assigned to a subfamily now termed alpha-chemokines. The alpha-chemokines contain four cysteine residues at highly conserved positions, which enclose the core region of the molecules. The first two cysteines are separated by a single amino acid, forming a motif (CXC) that distinguishes the alpha-chemokine from the beta-chemokine subfamily, where these cysteines are in directly adjacent positions.
Biological Activity: Determined by its ability to chemoattract human monocytes using a concentration range of 2.0-40.0 ng/ml.
Description: Recombinant NAP-2 is a disulfide-linked monomeric protein consisting of 71 amino acid residues and migrates as an approximately 8 kDa protein under non-reducing conditions and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human NAP-2 (CXCL7) mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered 20 mM Phosphate buffer, 100 mM NaCl, pH 7.5.
Genbank: P02775
Purity: ≥98% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P02775
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. J. Nucl. Med., Jul 2004, 45: 1217 - 1223.
2. Genes Cells, Jan 2003, 8: 9 - 15.
3. J. Biol. Chem., Mar 1995, 270: 6338.
English
Deutsch
