Products from BPS Bioscience require a minimum order value above 400€
Encompassing Amino Acids: 32-115
Amino Acid Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Background: Parathyroid hormone is a circulating hormone that acts as the central regulator of calcium metabolism by directly targeting bone, kidney, and intestine. The classical concept of PTH action is that it regulates serum calcium levels by stimulating bone resorption, however, intermittent administration of PTH selectively stimulates bone formation. It is now known that PTH binds to its receptor PTH1R, and activates the G protein α subunits.Besides PKA and PKC activation, PTH also regulates MAPKs including p42/p44 ERKs, p38, and c-Jun N-terminal kinase subtypes.
Biological Activity: The activity was determined by the dose-dependent proliferation of human UMR106 cells and was found to be 1 x 104 IU/mg.
Description: Recombinant Human PTH-84 is a disulfide-linked homodimeric protein consisting of 84 amino acid residues, and migrates as an approximately 9 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human PTH mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered phosphate buffer solution, pH 7.
Genbank: P01270
Purity: ≥95% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: P01270
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Esbrit P, Alcaraz MJ. Biochem Pharmacol. 2013 May 15,85(10):1417-23.
2. Bellido T, et al. Bone. 2013 Jun,54(2):250-7.
English
Deutsch
