Human RANTES (CCL5) Recombinant

Human RANTES (CCL5) Recombinant
SKU
BPS90232-B
Packaging Unit
20 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 24-91

Amino Acid Sequence: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Background: RANTES belongs to the family of chemotactic cytokines known as Chemokines. RANTES is expressed by an early response gene. The synthesis of RANTES is induced by TNF-alpha and IL-1alpha. RANTES is chemotactic for T-cells, human eosinophils and basophils and plays an active role in recruiting leukocytes into inflammatory sites. RANTES also activates eosinophils to release eosinophilic cationic protein. It changes the density of eosinophils and makes them hypodense, which is thought to represent a state of generalized cell activation and is associated most often with diseases such as asthma and allergic rhinitis. RANTES also is a potent activator of oxidative metabolism specific for eosinophils. RANTES increases the adherence of monocytes to endothelial cells. It selectively supports the migration of monocytes and T-lymphocytes expressing the cell surface markers CD4 and UCHL1. These cells are thought to be pre-stimulated T-helper cells with memory T-cell functions. RANTES activates human basophils from some select basophil donors and causes the release of histamines.

Biological Activity: Determined by its ability to chemoattract human blood monocytes using a concentration range of 1.0-10.0 ng/ml.

Description: Recombinant RANTES/CCL5 is a disulfide-linked monomer protein consisting of 69 amino acid residue subunits and migrates as an approximately 8 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human RANTES mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution.

Genbank: P13501

Purity: ≥98% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P13501

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Lv, D., et al. Cell Mol Immunol. 2013 Jul,10(4):303-10.
2. Suffee N, et al.
2. Biochem Soc Trans. 2011 Dec,39(6):1649-53.
3. Katsounas A, et al. Int Rev Immunol. 2011 Oct-Dec,30(5-6):366-78.
More Information
SKU BPS90232-B
Manufacturer BPS Bioscience
Manufacturer SKU 90232-B
Package Unit 20 µg
Quantity Unit STK
Product information (PDF)
×
MSDS (PDF)
×