Mn SOD Protein

Human Recombinant Mn SOD Protein
SKU
STRSPR-131A
Packaging Unit
50 µg
Manufacturer
Stressmarq Biosciences

Availability: loading...
Price is loading...
Target: Mn SOD .

Nature: Recombinant.

Swiss-Prot: P04179.

Expression System: E. coli.

Amino Acid Sequence: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK.

Purification: Affinity Purified.

Purity: >90%.

Storage Buffer: 50mM Tris/HCl pH7.7, 0.15M NaCl, 5mM DTT, 10% glycerol.

Protein Size: ~25 kDa.

Conjugate: His tag.

Cellular Localization: Mitochondrion Matrix.

Scientific Background: Superoxide dismutase (SOD) is an endogenously produced intracellular enzyme present in almost every cell in the body (3). It works by catalyzing the dismutation of the superoxide radical O2ˉ to O2 and H2O2, which are then metabolized to H2O and O2 by catalase and glutathione peroxidase (2, 5). In general, SODs play a major role in antioxidant defense mechanisms (4). There are two main types of SOD in mammalian cells. One form (SOD1) contains Cu and Zn ions as a homodimer and exists in the cytoplasm. The two subunits of 16 kDa each are linked by two cysteines forming an intra-subunit disulphide bridge (3). The second form (SOD2) is a manganese containing enzyme and resides in the mitochondrial matrix. It is a homotetramer of 80 kDa. The third form (SOD3 or EC-SOD) is like SOD1 in that it contains Cu and Zn ions, however it is distinct in that it is a homotetramer, with a mass of 30 kDA and it exists only in the extracellular space(8). SOD3 can also be distinguished by its heparin-binding capacity (1).

References: 1. Adachi T., et al. (1992) Clin. Chim. Acta. 212: 89-102.2. Barrister J.V., et al. (1987) Crit. Rev. Biochem. 22: 111-180.3. Furukawa Y., and O'Halloran T. (2006) Antioxidants &Redo Signaling. 8 (No 5): 6.4. Gao B., et al. (2003). Am J Physiol Lung Cell Mol Physiol. 284: L917-L925.5. Hassan H.M. (1988). Free Radical Biol. Med. 5: 377-385.6. Kurobe N., et al. (1990) Clinica Chimica Acta. 192: 171-180.7. Ojika T., et al. (1991) Acta Histochem Cytochem. 24(50): 489-495.8. Wispe J.R., et al. (1989) BBA. 994: 30-36.

Field of Use: Not for use in humans. Not for use in diagnostics or therapeutics. For research use only.
More Information
SKU STRSPR-131A
Manufacturer Stressmarq Biosciences
Manufacturer SKU SPR-131A
Green Labware No
Package Unit 50 µg
Quantity Unit STK
Reactivity Human
Application Western Blotting, SDS-PAGE
Human Gene ID 24787
Product information (PDF) Download
MSDS (PDF) Download