Human S100 Calcium Binding Protein A4 Recombinant

Human S100 Calcium Binding Protein A4 Recombinant
SKU
BPS90234-A
Packaging Unit
2 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK

Background: S100A4 is a calcium-binding protein related to the S100 family of proteins. It is known also as a growth-related protein, CAPL. It is expressed at high levels in different mouse metastatic cells and in normal tissues (thymus, spleen) and activated macrophages, T-cells, neutrophils, monocytes, and macrophages.

Description: Recombinant S100-A4 is a disulfide-linked homodimer protein consisting of 332 amino acid residues (containing a C-terminal IgG1 Fc tag), and migrates as an approximately 12 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human S100-A4 mature chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution.

Genbank: P26447

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P26447

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Mishra SK, et al. Cancer Metastasis Rev. 2012 Jun,31(1-2):163-72.
2. Boye K, Maelandsmo GM. Am J Pathol. 2010 Feb,176(2):528-35.
More Information
SKU BPS90234-A
Manufacturer BPS Bioscience
Manufacturer SKU 90234-A
Green Labware No
Package Unit 2 µg
Quantity Unit STK
Host Escherichia Coli
Product information (PDF)
×
MSDS (PDF)
×