Human Tumor Necrosis Factor-beta Recombinant

Human Tumor Necrosis Factor-beta Recombinant
SKU
BPS90245-A
Packaging Unit
5 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Encompassing Amino Acids: 35-205

Amino Acid Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Background: TNF-β is a potent mediator of inflammatory and immune responses. It belongs to the TNF family of ligands and signals through TNFR1 and TNFR2. TNF-β is produced by activated T and B lymphocytes, and has similar activities to TNF-alpha. Like TNF-α, TNF-β is involved in the regulation of various biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. TNF-β is secreted as a soluble polypeptide, but can form heterotrimers with lymphotoxin-β, which effectively anchors the TNF- β to the cell surface. TNF-β is cytotoxic to a wide range of tumor cells.

Biological Activity: The ED50 was measured in a cytotoxicity assay using mouse L929 cells in the presence of the metabolic inhibitor actinomycin, and was determined to be less than 0.1 ng/ml.

Description: Recombinant TNF-beta is a non disulfide-linked homotrimer protein, each consisting of 172 amino acids and migrates as an approximately 21 kDa protein under reducing conditions. Optimized DNA sequence encoding Human Tumor Necrosis Factor-beta chain was expressed in E. coli.

Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.

Format: lyophilized protein

Formulation: Lyophilized from a 0.2 µm filtered PBS solution, pH 7.5.

Genbank: P01374

Purity: ≥95% by SDS-PAGE and HPLC

Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.

Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.

Uniprot: P01375

Warnings: Avoid freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Ishibashi, K., et al. Leuk Lymphoma. 1992 Aug,7(5-6):409-17.
2. Tracey KJ, Cerami A. Annu Rev Med. 1994,45:491-503
3. Sedgwick JD, et al. Immunol Today. 2000 Mar,21(3):110-3.
More Information
SKU BPS90245-A
Manufacturer BPS Bioscience
Manufacturer SKU 90245-A
Package Unit 5 µg
Quantity Unit STK
Host Escherichia Coli
Product information (PDF)
×
MSDS (PDF)
×