ICAM1 Antibody - N-terminal region : Biotin

ICAM1 Antibody - N-terminal region : Biotin
SKU
AVIARP59129_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ICAM1

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: LLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Intercellular adhesion molecule 1

Protein Size: 532

Purification: Affinity Purified
More Information
SKU AVIARP59129_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59129_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3383
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×