Igf2bp1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Igf2bp1 is a RNA-binding factor that affects mRNA nuclear export, localization, stability and translation.

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Insulin-like growth factor 2 mRNA-binding protein 1

Protein Size: 577

Purification: Affinity Purified

• SKU: AVIARP58385_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58385_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 140486
• Host: Rabbit
• Conjugate: Conjugated, FITC