IL17A Antibody - N-terminal region : FITC

IL17A Antibody - N-terminal region : FITC
SKU
AVIARP59132_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL17A

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Interleukin-17A

Protein Size: 155

Purification: Affinity Purified
More Information
SKU AVIARP59132_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59132_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3605
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×