ILDR1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ILDR1 is a putative membrane receptor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ILDR1

Key Reference: Hauge,H., (2004) Biochem. Biophys. Res. Commun. 323 (3), 970-978

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Immunoglobulin-like domain-containing receptor 1

Protein Size: 502

Purification: Affinity Purified

• SKU: AVIARP55751_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55751_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 286676
• Host: Rabbit