Itgb1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Itgb1 plays a mechanistic adhesive role during telophase, required for the successful completion of cytokinesis.

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: PDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Integrin beta-1

Protein Size: 798

Purification: Affinity Purified

• SKU: AVIARP58832_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58832_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 16412
• Host: Rabbit
• Conjugate: Conjugated, Biotin