JARID2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 139kDa

Peptide Sequence: Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Jumonji

Protein Size: 1246

Purification: Affinity Purified

• SKU: AVIARP58842_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58842_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3720
• Host: Rabbit
• Conjugate: Conjugated, Biotin