JMJD2B Antibody - middle region : Biotin

JMJD2B Antibody - middle region : Biotin
SKU
AVIARP58398_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. Human genes corresponding to KIAA0677, KIAA0876, KIAA0780 and FLJ10251 cDNAs were designated JMJD2A, JMJD2B, JMJD2C, and JMJD2D, respectively. In addition, JMJD2D homologous genes within human genome sequences AP002383.3 and AP001264.4 were designated JMJD2E and JMJD2F, respectively. C2HC2HC2- and C5HC2-type Cys (His) clusters were identified as the region conserved among JMJD2A (1064 aa), JMJD2B (1096 aa), and JMJD2C (1056 aa) proteins. JMJD2A, JMJD2B and JMJD2C consist of JmjN, JmjC, JD2H, and two TUDOR domains.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD2B

Key Reference: Katoh,Y. (2007) Int. J. Mol. Med. 20 (2), 269-273

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysine-specific demethylase 4B

Protein Size: 1096

Purification: Affinity Purified
More Information
SKU AVIARP58398_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58398_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Dog (Canine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23030
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×