KNG1 Antibody - N-terminal region : HRP

KNG1 Antibody - N-terminal region : HRP
SKU
AVIARP59203_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kininogen-1 Ensembl ENSP00000396025

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP59203_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59203_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 3827
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×