KPTN Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: KPTN may be involved in actin dynamics. KPTN may play a role in producing the sensory apparatus in hair cells. KPTN may also play a role in actin rearrangements that accompany platelet activation and stereocilia formation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KPTN

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: MGEAAVAAGPCPLREDSFTRFSSQSNVYGLAGGAGGRGELLAATLKGKVL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Kaptin

Protein Size: 436

Purification: Affinity Purified

• SKU: AVIARP58488_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58488_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11133
• Host: Rabbit
• Conjugate: Conjugated, Biotin