KRT75 Antibody - middle region : Biotin

KRT75 Antibody - middle region : Biotin
SKU
AVIARP58769_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. This gene is expressed in the companion

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human KRT75

Key Reference: Schweizer,J., (2006) J. Cell Biol. 174 (2), 169-174

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Keratin, type II cytoskeletal 75

Protein Size: 551

Purification: Affinity Purified
More Information
SKU AVIARP58769_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58769_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rabbit, Dog (Canine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9119
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×