LAG3 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAG3

Molecular Weight: 55kDa

Peptide Sequence: Synthetic peptide located within the following region: GFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lymphocyte activation gene 3 protein

Protein Size: 525

Purification: Affinity Purified

• SKU: AVIARP59142_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59142_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Yeast
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 3902
• Host: Rabbit
• Conjugate: Conjugated, Biotin