LAMP1 Antibody - N-terminal region : Biotin

LAMP1 Antibody - N-terminal region : Biotin
SKU
AVIARP58911_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAMP1

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: NMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 355

Purification: Affinity Purified
More Information
SKU AVIARP58911_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58911_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 3916
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×