LAX1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LAX1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: ADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGPGTQLL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ55255, highly similar to Lymphocyte transmembrane adapter 1 EMBL BAH13480.1

Protein Size: 382

Purification: Affinity Purified

• SKU: AVIARP59140_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59140_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54900
• Host: Rabbit
• Conjugate: Conjugated, HRP