LCN8 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The exact function of LCN8 is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN8

Key Reference: Suzuki,K., Gene 339, 49-59 (2004)

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epididymal-specific lipocalin-8

Protein Size: 152

Purification: Affinity Purified

• SKU: AVIARP58490_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58490_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 138307
• Host: Rabbit
• Conjugate: Conjugated, Biotin