LGALS1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS1

Key Reference: Bi,S., (2008) J. Biol. Chem. 283 (18), 12248-12258

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: galectin-1

Protein Size: 135

Purification: Affinity Purified

• SKU: AVIARP58491_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58491_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 3956
• Host: Rabbit
• Conjugate: Conjugated, HRP