LRRFIP1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury through PDGFA repression. LRRFIP1 may also bind double-stranded RNA.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LRRFIP1

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: ERQKEFFDSVRSERDDLREEVVMLKEELKKHGIILNSEIATNGETSDTLN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat flightless-interacting protein 1 Ensembl ENSP00000310109

Protein Size: 640

Purification: Affinity Purified

• SKU: AVIARP59016_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59016_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 9208
• Host: Rabbit
• Conjugate: Conjugated, Biotin