LRRTM1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LRRTM1 may play a role during the development of specific forebrain structures by influencing neuronal differentiation and connectivity, with a possible role in intracellular trafficking within axons.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRRTM1

Key Reference: Francks,C., (2007) Mol. Psychiatry 12 (12), 1129-1139

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: CALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine-rich repeat transmembrane neuronal protein 1

Protein Size: 522

Purification: Affinity Purified

• SKU: AVIARP55788_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55788_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 347730
• Host: Rabbit