Lynx1 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lynx1 seems to modulate nicotinic acetylcholine receptors. It promotes the largest of three current amplitudes elicited by ACh through alpha4beta2 nAChRs and that LYNX1 enhances desensitization.

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ly-6/neurotoxin-like protein 1

Protein Size: 116

Purification: Affinity Purified

• SKU: AVIARP58708_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58708_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23936
• Host: Rabbit
• Conjugate: Conjugated, HRP