LYPLA2 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Acyl-protein thioesterase 2

Protein Size: 231

Purification: Affinity Purified

• SKU: AVIARP58638_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58638_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Human Gene ID: 11313
• Host: Rabbit
• Conjugate: Conjugated, HRP