LZTS2 Antibody - N-terminal region : Biotin

LZTS2 Antibody - N-terminal region : Biotin
SKU
AVIARP58817_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis. LZTS2 may negatively regulate axonal outgrowth by preventing the for

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LZTS2

Key Reference: Hyun (2008) Biochim. Biophys. Acta 1783 (3), 419-428

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leucine zipper putative tumor suppressor 2

Protein Size: 669

Purification: Affinity Purified
More Information
SKU AVIARP58817_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58817_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 84445
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×