MAPK12 Antibody - N-terminal region : HRP

MAPK12 Antibody - N-terminal region : HRP
SKU
AVIARP56535_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAPK12

Key Reference: Qi,X., (2007) J. Biol. Chem. 282 (43), 31398-31408

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 12

Protein Size: 367

Purification: Affinity Purified
More Information
SKU AVIARP56535_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56535_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 6300
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×