MAPK3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK3

Key Reference: Seomun,Y. (2008) Biochem. Biophys. Res. Commun. 372 (1), 221-225

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 3

Protein Size: 379

Purification: Affinity Purified

• SKU: AVIARP56432_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56432_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5595
• Host: Rabbit