MAPK4 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targe

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK4

Key Reference: Murtagh,J.J. (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (19), 6870-6875

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitogen-activated protein kinase 4

Protein Size: 587

Purification: Affinity Purified

• SKU: AVIARP56433_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56433_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 5596
• Host: Rabbit