MATN2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: MATN2 is a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined.This gene encodes a member of the von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains five von Willebrand factor A domains. The specific function of this gene has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN2

Key Reference: Ichikawa,T., (2008) Biochem. Biophys. Res. Commun. 369 (4), 994-1000

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Matrilin-2

Protein Size: 937

Purification: Affinity Purified

• SKU: AVIARP57667_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57667_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 4147
• Host: Rabbit