MERTK Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK

Key Reference: N/A

Molecular Weight: 109kDa

Peptide Sequence: Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tyrosine-protein kinase Mer

Protein Size: 999

Purification: Affinity purified

• SKU: AVIARP59019_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP59019_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10461
• Host: Rabbit
• Conjugate: Conjugated, HRP