METTL4 antibody

Calculated MW: 54

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: Enables RNA methyltransferase activity and site-specific DNA-methyltransferase (adenine-specific) activity. Involved in nucleic acid metabolic process; regulation of RNA metabolic process; and regulation of mitochondrial DNA replication. Located in cytosol; mitochondrial matrix; and nucleus. [provided by Alliance of Genome Resources, Apr 2022]

Uniprot ID: Q8N3J2

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human Mettl4: SGEFVFPLDSLHKKPYECLVLGRVKEKTALALRNEAVRTPPVPDQRLIVS .

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: methyltransferase like 4

• SKU: GTX04574-100
• Manufacturer: GeneTex
• Manufacturer SKU: GTX04574-100
• Green Labware: No
• Package Unit: 100 μl
• Quantity Unit: STK
• Reactivity: Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Isotype: IgG
• Human Gene ID: 64863
• Host: Rabbit