MGC34821 Antibody - middle region : Biotin

MGC34821 Antibody - middle region : Biotin
SKU
AVIARP56052_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC34821

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Solute carrier family 22 member 24 Ensembl ENSP00000396586

Protein Size: 551

Purification: Affinity Purified
More Information
SKU AVIARP56052_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56052_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283238
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×