MGC50273 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC50273

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C2orf27

Protein Size: 209

Purification: Affinity Purified

• SKU: AVIARP56022_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56022_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 408029
• Host: Rabbit