Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR
Background: VEGF is a homodimeric heavily glycosylated protein.The human factor occurs in several molecular variants of 121, 162, 145, 148, 165, 183, 189 , 206 amino acids, arising by alternative splicing of the mRNA.The splice forms of VEGF differ in biological properties such as the receptor types they recognize and their interaction with heparan sulfate proteoglycans. The 165 amino acid form of the factor is the most common form in most tissues. Kaposi sarcomas express VEGF121 and VEGF165. VEGF121 and VEGF165 are soluble secreted forms of the factor while VEGF189 and VEGF206 are mostly bound to heparin-containing proteoglycans in the cell surface or in the basement membrane. A high-affinity glycoprotein receptor of 170-235 kDa is expressed on vascular endothelial cells. The interaction of VEGF with heparin-like molecules of the extracellular matrix is required for efficient receptor binding. The high-affinity receptor for VEGF, now known as VEGFR1, has been identified as the gene product of the FLT-1. Another receptor for VEGF, now known as VEGFR2, is KDR, also known as FLK-1. A third receptor type, VEGFR3 is known also as FLT- 4. An isoform-specific receptor for VEGF165 has been identified as human Neuropilin-1.
Biological Activity: The ED50 was determined by the dose-dependent proliferation of human umbilical vein endothelial cells and was found to be in the range of 2.0-4.0 ng/ml.
Description: Recombinant Vascular endothelial growth factor is a disulfide-linked homodimer protein consisting of 121 amino acid residues, and migrates as an approximately 28 kDa protein under non-reducing and as 14 kDa under reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Mouse Vascular Endothelial Growth Factor mature chain was expressed in E. coli.
Endotoxin Level: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Format: lyophilized protein
Formulation: Lyophilized from a 0.2 µm filtered solution of 2.5% glycine, 0.5% sucrose, 0.01% Tween-80, 5 mM glutamic acid, pH 4.5.
Genbank: Q00731
Purity: ≥96% by SDS-PAGE and HPLC
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Storage Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20°C. Upon reconstitution, store in working aliquots at +4°C for up to one month, or at -20°C for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Uniprot: Q00731
Warnings: Avoid freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Kawai H, et al. Lung Cancer. 2008 Jan,59(1):41-7.
2. Pan Q, et al. J Biol Chem. 2007 Aug 17,282(33):24049-56.