MRPL48 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPL48

Key Reference: Zhang,Z. (2003) Genomics 81 (5), 468-480

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 39S ribosomal protein L48, mitochondrial

Protein Size: 212

Purification: Affinity Purified

• SKU: AVIARP56816_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56816_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51642
• Host: Rabbit