MRPS2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPS2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 28S ribosomal protein S2, mitochondrial

Protein Size: 296

Purification: Affinity Purified

• SKU: AVIARP56813_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56813_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51116
• Host: Rabbit