MUC3B Antibody - middle region : FITC

MUC3B Antibody - middle region : FITC
SKU
AVIARP58396_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MUC3B

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 1009

Purification: Affinity Purified
More Information
SKU AVIARP58396_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58396_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57876
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×