MUC3B Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MUC3B

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: KTTLKEGLQNASQDANSCQDSQTLCFKPDSIKVNNNSKTELTPEAICRRA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 1009

Purification: Affinity Purified

• SKU: AVIARP58396_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58396_P050-HRP
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57876
• Host: Rabbit
• Conjugate: Conjugated, HRP