MUC3B Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B

Key Reference: 0

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 310

Purification: Affinity Purified

• SKU: AVIARP58395_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58395_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 57876
• Host: Rabbit
• Conjugate: Conjugated, Biotin