NDOR1 Antibody - N-terminal region : Biotin

NDOR1 Antibody - N-terminal region : Biotin
SKU
AVIARP56043_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants.

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 412

Purification: Affinity Purified
More Information
SKU AVIARP56043_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56043_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27158
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×