NFATC1 Antibody - N-terminal region : FITC

NFATC1 Antibody - N-terminal region : FITC
SKU
AVIARP59145_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: HVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear factor of activated T-cells, cytoplasmic 1

Protein Size: 353

Purification: Affinity Purified
More Information
SKU AVIARP59145_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59145_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 4772
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×