Nfkbiz Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Nfkbiz is involved in regulation of NF-kappa-B transcription factor complexes. It inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. It inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. It seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50, Nfkbiz has transcriptional activation activity and, together with NFKB1/p50 and RELA, Nfkbiz is recruited to LCN2 promoters.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: NF-kappa-B inhibitor zeta

Protein Size: 728

Purification: Affinity Purified

• SKU: AVIARP57676_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57676_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 80859
• Host: Rabbit