NRP1 Antibody - N-terminal region : HRP

NRP1 Antibody - N-terminal region : HRP
SKU
AVIARP59101_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NRP1 is a membrane-bound coreceptor to a tyrosine kinase receptor for both vascular endothelial growth factor (VEGF; MIM 192240) and semaphorin (see SEMA3A; MIM 603961) family members. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRP1

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Neuropilin-1

Protein Size: 644

Purification: Affinity Purified
More Information
SKU AVIARP59101_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP59101_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 8829
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×