ODF2L Antibody - N-terminal region : FITC

ODF2L Antibody - N-terminal region : FITC
SKU
AVIARP56175_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ODF2L

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Outer dense fiber protein 2-like

Protein Size: 513

Purification: Affinity Purified
More Information
SKU AVIARP56175_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56175_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57489
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×