Omp Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Omp may act as a modulator of the olfactory signal-transduction cascade.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: EDSDAMDWNEADALEFGERLSDLAKIRKVMYFLITFGEGVEPANLKASVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified

• SKU: AVIARP56669_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56669_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 18378
• Host: Rabbit