OTUB1 Antibody - N-terminal region : Biotin

OTUB1 Antibody - N-terminal region : Biotin
SKU
AVIARP56999_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OTUB1

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: DRIQQEIAVQNPLVSERLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ubiquitin thioesterase OTUB1

Protein Size: 271

Purification: Affinity Purified
More Information
SKU AVIARP56999_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56999_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55611
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×