PAX1 Antibody - middle region : FITC

PAX1 Antibody - middle region : FITC
SKU
AVIARP58040_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates.The PAX genes, including PAX1, are a highly conserved family of developmental control genes that encode transcription factors and have been shown to play a role in pattern formation during embryogenesis in vertebrates (McGaughran et al., 2003 [PubMed 12774041]). See PAX7 (MIM 167410) for a discussion of paired box domain genes.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PAX1

Key Reference: Vatanavicharn,N., (2007) Am. J. Med. Genet. A 143 (19), 2292-2302

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: SISRILRNKIGSLAQPGPYEASKQPPSQPTLPYNHIYQYPYPSPVSPTGA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Paired box protein Pax-1

Protein Size: 440

Purification: Affinity Purified
More Information
SKU AVIARP58040_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58040_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5075
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×