PCSK4 Antibody - N-terminal region : FITC

PCSK4 Antibody - N-terminal region : FITC
SKU
AVIARP58649_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PCSK4 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. PCSK4 plays a role in transcriptional coactivation. PCSK4 may be involved in stabilizing the multiprotein transcription complex.Proprotein convertases, including PCSK4, are calcium-dependent serine proteases related to bacterial subtilisins and to yeast kexin. These enzymes process precursor proteins to their active forms by selective cleavage of the polypeptide at sites following paired basic amino acids. In mammals, this family comprises PC1 (MIM 162150), PC2 (MIM 162151), PC4, PC5 (MIM 600488), furin (FUR; MIM 136950), and PACE4 (MIM 167405). Substrates for these enzymes range from prohormones to precursors for growth factors to cell surface receptors and viral surface glycoproteins (Cao et al., 2001 [PubMed 11776387]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-31 AC027307.5 80201-80231 c 32-257 AY358963.1 32-257 258-655 AK057235.1 452-849 656-2528 AY358963.1 656-2528 2529-2606 AL043305.1 210-287 2607-2674 AA453604.1 1-68 c

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PCSK4

Key Reference: Qiu,Q., (2005) Proc. Natl. Acad. Sci. U.S.A. 102 (31), 11047-11052

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proprotein convertase subtilisin/kexin type 4

Protein Size: 755

Purification: Affinity Purified
More Information
SKU AVIARP58649_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58649_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54760
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×